PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG038500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 483aa    MW: 52109.4 Da    PI: 4.4403
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG038500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1901.5e-581104792373
                 GRAS   2 velLlecAeavssgdlelaqalLarlsel......aspdgd.......pmqRlaayfteALaarlarsvselykalppsetseknsseel 78 
                           +lL++ A+av+++d  +a+++L+rl +l      +    +       +   la yf+++L++r+++  se+       +++    ++++
  Pavir.3KG038500.1.p 110 NDLLVTGARAVEAQDSIRASTILSRLDDLvpgvpcR----SfhhaaasSSDHLACYFARGLRSRISGARSECH------PAAAAAPENRM 189
                          689*************************96654442....12223344999****************444444......44434467799 PP

                 GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetg 162
                           a+++++e+sP++kf+h+taNqaIlea++ +  vH++D ++++G+QW++L+  La   ++p  + +T+v+ ++ +         +  + +
  Pavir.3KG038500.1.p 190 PAYRMLQELSPLIKFAHFTANQAILEATADDPGVHVVDHNVGEGVQWASLMSDLARHGGKP--FHLTAVVTADDDadsaaaAGGSHPAAA 277
                          *******************************************************865554..566777776666667675556666788 PP

                 GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe...adhn 249
                          + L++fA +l++pf+++ l+ ++ edl+  + + + g ++ V++    ++      sl   + ++L  vk l+Pk+v+++eqe   +d++
  Pavir.3KG038500.1.p 278 RWLSEFAGSLNLPFRYSSLHLRSEEDLRGFATSGNGGGSVTVSCDTTDKSYS----SLIRLQMQLLGSVKILRPKLVILIEQEpfrIDRG 363
                          88*****************99999999999999999********99554443....4444556********************9888999 PP

                 GRAS 250 sesFlerflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                           ++F+e f+e  ++++a ++sle+ +           vE+e lg+ i+++v + +              +  e  GF++ +ls+++++q 
  Pavir.3KG038500.1.p 364 LAPFAEFFCEVQQHFAATLESLESCFRDGGygACLGPVEKETLGPMIEDAVRQYEPL----AG-----GAGAELEGFRACELSSFNVAQG 444
                          9************************977767777889**************988776....22.....3456889*************** PP

                 GRAS 338 klllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          k+l   ++ +g+ v +e+g l l+W++rpL+svS+W
  Pavir.3KG038500.1.p 445 KMLAGLFS-RGFGVAQEEGRLALCWNSRPLTSVSVW 479
                          *******9.*************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.1283461IPR005202Transcription factor GRAS
PfamPF035145.3E-56110479IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
METMSYPCSP LIPFPTQHEE SSYLLWSPQV VIPLENGNMC DGDADPSPDQ QQQDHEFMDI  60
MIQEASRLLL QDDLSDGDPS LSGFDQKLEG QENGSLLAVQ EEFMEESSLN DLLVTGARAV  120
EAQDSIRAST ILSRLDDLVP GVPCRSFHHA AASSSDHLAC YFARGLRSRI SGARSECHPA  180
AAAAPENRMP AYRMLQELSP LIKFAHFTAN QAILEATADD PGVHVVDHNV GEGVQWASLM  240
SDLARHGGKP FHLTAVVTAD DDADSAAAAG GSHPAAARWL SEFAGSLNLP FRYSSLHLRS  300
EEDLRGFATS GNGGGSVTVS CDTTDKSYSS LIRLQMQLLG SVKILRPKLV ILIEQEPFRI  360
DRGLAPFAEF FCEVQQHFAA TLESLESCFR DGGYGACLGP VEKETLGPMI EDAVRQYEPL  420
AGGAGAELEG FRACELSSFN VAQGKMLAGL FSRGFGVAQE EGRLALCWNS RPLTSVSVWS  480
PV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-2115147936374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978326.20.0PREDICTED: nodulation-signaling pathway 2 protein-like
TrEMBLK3YE270.0K3YE27_SETIT; Uncharacterized protein
STRINGSi012487m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.12e-27GRAS family protein